General Information

  • ID:  hor006013
  • Uniprot ID:  P84900(52-62)
  • Protein name:  Phyllokinin
  • Gene name:  NA
  • Organism:  Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa hypochondrialis)
  • Family:  Frog skin active peptide (FSAP) family, Bradykinin-related peptide subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pithecopus (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RPPGFSPFRIY
  • Length:  11(52-62)
  • Propeptide:  MSILKKSLFLVLFLGLVSFSICEEEKREAEEEENEDEIEEESDEKKRESPDRPPGFSPFRIY
  • Signal peptide:  MSILKKSLFLVLFLGLVSFSIC
  • Modification:  T3 4-hydroxyproline;T11 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle (By similarity). May target bradykinin receptors (BDKRB).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P84900-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006013_AF2.pdbhor006013_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 151508 Formula: C65H93N17O14
Absent amino acids: ACDEHKLMNQTVW Common amino acids: P
pI: 11.15 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -56.36 Boman Index: -2156
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 35.45
Instability Index: 10156.36 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  16713656
  • Title:  Elements of the granular gland peptidome and transcriptome persist in air-dried skin of the South American orange-legged leaf frog, Phyllomedusa hypocondrialis.
  • PubMed ID:  16797783
  • Title:  Bradykinin-related peptides from Phyllomedusa hypochondrialis.
  • PubMed ID:  17120273
  • Title:  Bradykinin-related peptides f